PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00040.1_g00044.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family CO-like
Protein Properties Length: 354aa    MW: 39437.7 Da    PI: 7.2129
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00040.1_g00044.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box18.93.2e-061052440
                 zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                             + C+++ +   + +C+ ++ +lC +C  + H        H++v
  Rsa1.0_00040.1_g00044.1 10 QACDTCRSAACTVYCRADSAYLCTSCDAQVHAAnrlasrHERV 52
                             57******99*********************556788888776 PP

2zf-B_box35.61.9e-115297342
                 zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                              r+C+ +e+ ++ +fC+ +   lC  C +++H+       H++vp+
  Rsa1.0_00040.1_g00044.1 52 VRVCQSCERAPAAFFCKADAASLCTACDSQIHSAnplarrHQRVPI 97
                             689*****************************66899999**9997 PP

3CCT67.34.1e-23287331145
                      CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqae 45 
                              R+a+++RY+eK+ktRkFeK+irY+sRK++Ae+RpR+KGrF+k++e
  Rsa1.0_00040.1_g00044.1 287 RKARVMRYREKKKTRKFEKTIRYASRKEYAEKRPRIKGRFAKRNE 331
                              9*****************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.85754IPR000315B-box-type zinc finger
SMARTSM003361.8E-8754IPR000315B-box-type zinc finger
CDDcd000216.27E-81254No hitNo description
PROSITE profilePS5011912.2875097IPR000315B-box-type zinc finger
PfamPF006434.5E-95297IPR000315B-box-type zinc finger
CDDcd000214.73E-105397No hitNo description
SMARTSM003361.9E-125597IPR000315B-box-type zinc finger
PROSITE profilePS5101716.648287329IPR010402CCT domain
PfamPF062032.5E-17287329IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009909Biological Processregulation of flower development
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048576Biological Processpositive regulation of short-day photoperiodism, flowering
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:0005622Cellular Componentintracellular
GO:0008270Molecular Functionzinc ion binding
GO:0042802Molecular Functionidentical protein binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MLKQESNWAQ ACDTCRSAAC TVYCRADSAY LCTSCDAQVH AANRLASRHE RVRVCQSCER  60
APAAFFCKAD AASLCTACDS QIHSANPLAR RHQRVPILPI SGSMATNHSS ETTEPENIVV  120
VGQEEEDEAE AASWLLPSSV KNCGDNNNNN NNNNNNNNNS SQSNRFSVGE EYLDLVDYSS  180
SMDKRFIGQS NQYQQDYNVP QRSYVADGVV PLQVDVSKGH MHHEQHNYQF GFTNVSSEAY  240
GSSNGSPIHM VSLVPESTTT SDATVSPKAA TEELPNAPVQ MLSPMERKAR VMRYREKKKT  300
RKFEKTIRYA SRKEYAEKRP RIKGRFAKRN EVDADQGLST MVMFDTGYGI VPSF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU6940700.0EU694070.1 Brassica nigra isolate 1413 haplotype 1 COL1 (COL1) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009121539.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 1-like
SwissprotO500551e-165COL1_ARATH; Zinc finger protein CONSTANS-LIKE 1
TrEMBLQ8GRR60.0Q8GRR6_BRANI; COL1 protein
STRINGBra008668.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21282670
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15850.11e-144CONSTANS-like 1